Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaerhodopsin-3 (aop3)

This Recombinant Archaerhodopsin-3 (aop3) spans the amino acid sequence from region 7-258.

Product Specifications

Product Name Alternative

Archaerhodopsin-3, AR 3

UniProt

P96787

Expression Region

7-258

Origin

Halorubrum sodomense

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QAGYDLLGDGRPETLWLGIGTLLMLIGTFYFLVRGWGVTDKDAREYYAVTILVPGIASAA YLSMFFGIGLTEVTVGGEMLDIYYARYADWLFTTPLLLLDLALLAKVDRVTIGTLVGVDA LMIVTGLIGALSHTAIARYSWWLFSTICMIVVLYFLATSLRSAAKERGPEVASTFNTLTA LVLVLWTAYPILWIIGTEGAGVVGLGIETLLFMVLDVTAKVGFGFILLRSRAILGDTEAP EPSAGADVSAAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Formaldehyde-13C (20% by weight in water)
TRC-F691354-1G 1 g

Formaldehyde-13C (20% by weight in water)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS709165 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
FAM-xtra CPG *1000A*
6043-AAT 100 mg

FAM-xtra CPG *1000A*

Sign In for Pricing
View Details
Tissue FFPE Sections, Multiple urinary system sites
CS808646 5x 5 µm

Tissue FFPE Sections, Multiple urinary system sites

Sign In for Pricing
View Details
Human GNLY Antibody Pair Set
E-KAB-0503 50 µL & 100 µg

Human GNLY Antibody Pair Set

Sign In for Pricing
View Details
EP4 (PTGER4) Human Gene Knockout Kit (CRISPR)
KN210932RB 1 Kit

EP4 (PTGER4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details