Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio cholerae serotype O1 Type 4 prepilin-like proteins leader peptide-processing enzyme (tcpJ)

This Recombinant Vibrio cholerae serotype O1 Type 4 prepilin-like proteins leader peptide-processing enzyme (tcpJ) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

A5F385

Expression Region

1-253

Origin

Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEYVYLILFSIVSLILGSFSNVVIYRLPRKILLKNHFFYDIDSNRSMCPKCGNKISWYDN VPLLSYLLLHGKCRHCDEKISLSYFIVELSFFIIAFPIYWLSTDWVDSFVLLGLYFILFN LFVIDFKSMLLPNLLTYPIFMLAFIYVQQNPALTVESSIIGGFAAFIISYVSNFIVRLFK RIDVMGGGDIKLYTAIGTLIGVEFVPYLFLLSSIIAFIHWFFARVSCRYCLYIPLGPSII ISFVIVFFSIRLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-500 1x 500 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-100 1x 100 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL
BNC431050-100 1x 100 µL

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-500 1x 500 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details