Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio cholerae serotype O1 Type 4 prepilin-like proteins leader peptide-processing enzyme (tcpJ)

This Recombinant Vibrio cholerae serotype O1 Type 4 prepilin-like proteins leader peptide-processing enzyme (tcpJ) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

A5F385

Expression Region

1-253

Origin

Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEYVYLILFSIVSLILGSFSNVVIYRLPRKILLKNHFFYDIDSNRSMCPKCGNKISWYDN VPLLSYLLLHGKCRHCDEKISLSYFIVELSFFIIAFPIYWLSTDWVDSFVLLGLYFILFN LFVIDFKSMLLPNLLTYPIFMLAFIYVQQNPALTVESSIIGGFAAFIISYVSNFIVRLFK RIDVMGGGDIKLYTAIGTLIGVEFVPYLFLLSSIIAFIHWFFARVSCRYCLYIPLGPSII ISFVIVFFSIRLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED24 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
28308156 3x 1.0 µg DNA

MED24 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Iodoacetic Acid Sodium Salt
19305-82 25 g

Iodoacetic Acid Sodium Salt

Sign In for Pricing
View Details
FSHB CRISPR All-in-one AAV vector set (with saCas9)(Human)
20987151 3x 1.0 µg DNA

FSHB CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
SERPINB3 Mouse Monoclonal Antibody [Clone ID: LBI1G5]
AMM14027VCF 100 µg

SERPINB3 Mouse Monoclonal Antibody [Clone ID: LBI1G5]

Sign In for Pricing
View Details
IK Polyclonal Antibody
orb1413369 100 µL

IK Polyclonal Antibody

Sign In for Pricing
View Details
DFNB71 3'UTR Lenti-reporter-Luc Vector
18119081 1.0 µg

DFNB71 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details