Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus islandicus Cobalamin synthase (cobS)

This Recombinant Sulfolobus islandicus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C3MRS8

Expression Region

1-253

Origin

Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLKGVLALFSFFTAIPIKSNASLEEIAEYSYISPLIIGISLALIESAVYVLLYRILEAL AGIVLLGVVELLRGFNHLDGLLDLGDALMIKGDRERKIKALKDVEIGSGGIGLLLVYLSI QIVALLKLGFSFYTIFYLISSNVLSMTIGLYILSTISPIPESNLGKIFHNKLKGKSTVLL FELIPFISLYNIIVFLVFYMIMHKICRSLGGSSGDIAGASITLSFPLFLLTNEITNLNYS LLSILCYLFLYLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GGT1 Polyclonal Antibody
TMAB-06461-01 50 μL

Anti-GGT1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GGT1 Polyclonal Antibody
TMAB-06461-02 100 µL

Anti-GGT1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GGT1 Polyclonal Antibody
TMAB-06461-03 200 µL

Anti-GGT1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Integrin beta 4 ITGB4 Rabbit Monoclonal Antibody
M01015 100 µL/Vial

Anti-Integrin beta 4 ITGB4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PTTG2 Protein Vector (Human) (pPM-C-His)
PV114333 500 ng

PTTG2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Masses, Hooked
2012760/7 1 Each

Masses, Hooked

Sign In for Pricing
View Details