Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio cholerae serotype O1 Type 4 prepilin-like proteins leader peptide-processing enzyme (tcpJ)

This Recombinant Vibrio cholerae serotype O1 Type 4 prepilin-like proteins leader peptide-processing enzyme (tcpJ) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

P0C6D9

Expression Region

1-253

Origin

Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEYVYLILFSIVSLILGSFSNVVIYRLPRKILLKNHFFYDIDSNRSMCPKCGNKISWYDN VPLLSYLLLHGKCRHCDEKISLSYFIVELSFFIIAFPIYWLSTDWVDSFVLLGLYFILFN LFVIDFKSMLLPNLLTYPIFMLAFIYVQQNPALTVESSIIGGFAAFIISYVSNFIVRLFK RIDVMGGGDIKLYTAIGTLIGVEFVPYLFLLSSIIAFIHWFFARVSCRYCLYIPLGPSII ISFVIVFFSIRLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
BNC880181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-500 1x 500 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF488A conjugate, 0.1mg/mL
BNC880193-500 1x 500 µL

CD86 (BU63), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-500 1x 500 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details