Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio cholerae serotype O1 Type 4 prepilin-like proteins leader peptide-processing enzyme (tcpJ)

This Recombinant Vibrio cholerae serotype O1 Type 4 prepilin-like proteins leader peptide-processing enzyme (tcpJ) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

P0C6D9

Expression Region

1-253

Origin

Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEYVYLILFSIVSLILGSFSNVVIYRLPRKILLKNHFFYDIDSNRSMCPKCGNKISWYDN VPLLSYLLLHGKCRHCDEKISLSYFIVELSFFIIAFPIYWLSTDWVDSFVLLGLYFILFN LFVIDFKSMLLPNLLTYPIFMLAFIYVQQNPALTVESSIIGGFAAFIISYVSNFIVRLFK RIDVMGGGDIKLYTAIGTLIGVEFVPYLFLLSSIIAFIHWFFARVSCRYCLYIPLGPSII ISFVIVFFSIRLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS18 Peptide
orb1233622 0.1 mg

RGS18 Peptide

Sign In for Pricing
View Details
RGD1306820 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV643676 1.0 µg DNA

RGD1306820 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
XpressTM Human PD1 Over-expressing Cell Line (H22)
ABC-X0314C 1 Vial

XpressTM Human PD1 Over-expressing Cell Line (H22)

Sign In for Pricing
View Details
PTPRE antibody
10R-5526 100 ul

PTPRE antibody

Sign In for Pricing
View Details
Sheep Emopamil-Binding Protein-Like (EBPL) ELISA Kit
MBS9924567-01 48 Well

Sheep Emopamil-Binding Protein-Like (EBPL) ELISA Kit

Sign In for Pricing
View Details
Sheep Emopamil-Binding Protein-Like (EBPL) ELISA Kit
MBS9924567-02 96 Well

Sheep Emopamil-Binding Protein-Like (EBPL) ELISA Kit

Sign In for Pricing
View Details