Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium sp. Archaerhodopsin-2

This Recombinant Halobacterium sp. Archaerhodopsin-2 spans the amino acid sequence from region 7-259.

Product Specifications

Product Name Alternative

Archaerhodopsin-2, AR 2

UniProt

P29563

Expression Region

7-259

Origin

Halobacterium sp. (strain aus-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QAGFDLLNDGRPETLWLGIGTLLMLIGTFYFIARGWGVTDKEAREYYAITILVPGIASAA YLAMFFGIGVTEVELASGTVLDIYYARYADWLFTTPLLLLDLALLAKVDRVTIGTLIGVD ALMIVTGLIGALSKTPLARYTWWLFSTIAFLFVLYYLLTSLRSAAAKRSEEVRSTFNTLT ALVAVLWTAYPILWIVGTEGAGVVGLGIETLAFMVLDVTAKVGFGFVLLRSRAILGETEA PEPSAGADASAAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human OR13H1 (Olfactory receptor family 13 subfamily H member 1) Full Length
MPC3087K Each

Magic™ Membrane Protein Human OR13H1 (Olfactory receptor family 13 subfamily H member 1) Full Length

Sign In for Pricing
View Details
PSMD12 Recombinant Protein (Rat)
RP222665 100 µg

PSMD12 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Human DDB1- and CUL4-associated factor 8-like protein 1 (DCAF8L1) ELISA Kit
abx509748 96 Tests

Human DDB1- and CUL4-associated factor 8-like protein 1 (DCAF8L1) ELISA Kit

Sign In for Pricing
View Details
Lenti-HOXB8-RFP Lentivirus
LV635 10 mL

Lenti-HOXB8-RFP Lentivirus

Sign In for Pricing
View Details
PADI2 (Protein-arginine Deiminase Type-2, PAD-H19, Peptidylarginine Deiminase II, Protein-arginine Deiminase Type II, KIAA0994, PDI2) (AP) discontinued
130816-AP 100 µL

PADI2 (Protein-arginine Deiminase Type-2, PAD-H19, Peptidylarginine Deiminase II, Protein-arginine Deiminase Type II, KIAA0994, PDI2) (AP) discontinued

Sign In for Pricing
View Details
UCHL1 Antibody [A3D22]
C15843-100uL 100 µL

UCHL1 Antibody [A3D22]

Sign In for Pricing
View Details