Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium sp. Archaerhodopsin-2

This Recombinant Halobacterium sp. Archaerhodopsin-2 spans the amino acid sequence from region 7-259.

Product Specifications

Product Name Alternative

Archaerhodopsin-2, AR 2

UniProt

P29563

Expression Region

7-259

Origin

Halobacterium sp. (strain aus-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QAGFDLLNDGRPETLWLGIGTLLMLIGTFYFIARGWGVTDKEAREYYAITILVPGIASAA YLAMFFGIGVTEVELASGTVLDIYYARYADWLFTTPLLLLDLALLAKVDRVTIGTLIGVD ALMIVTGLIGALSKTPLARYTWWLFSTIAFLFVLYYLLTSLRSAAAKRSEEVRSTFNTLT ALVAVLWTAYPILWIVGTEGAGVVGLGIETLAFMVLDVTAKVGFGFVLLRSRAILGETEA PEPSAGADASAAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluo-8,-AM
E37F21080 1-mg

Fluo-8,-AM

Sign In for Pricing
View Details
Carboxyl Polystyrene Particles, 5% w/v, 2.0-2.4 µm
CP-20-100 100 mL

Carboxyl Polystyrene Particles, 5% w/v, 2.0-2.4 µm

Sign In for Pricing
View Details
TFR2 (Transferrin Receptor Protein 2, Transferrin Receptor 2)
493786 100 µL

TFR2 (Transferrin Receptor Protein 2, Transferrin Receptor 2)

Sign In for Pricing
View Details
Anti-Human ATF1 DyLight 550 conjugated Antibody
MBS1751360-01 0.1 mg

Anti-Human ATF1 DyLight 550 conjugated Antibody

Sign In for Pricing
View Details
Anti-Human ATF1 DyLight 550 conjugated Antibody
MBS1751360-02 5x 0.1 mg

Anti-Human ATF1 DyLight 550 conjugated Antibody

Sign In for Pricing
View Details
EPAS1 Protein Vector (Mouse) (pPM-C-His)
PV175817 500 ng

EPAS1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details