Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium sp. Archaerhodopsin-2

This Recombinant Halobacterium sp. Archaerhodopsin-2 spans the amino acid sequence from region 7-259.

Product Specifications

Product Name Alternative

Archaerhodopsin-2, AR 2

UniProt

P29563

Expression Region

7-259

Origin

Halobacterium sp. (strain aus-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QAGFDLLNDGRPETLWLGIGTLLMLIGTFYFIARGWGVTDKEAREYYAITILVPGIASAA YLAMFFGIGVTEVELASGTVLDIYYARYADWLFTTPLLLLDLALLAKVDRVTIGTLIGVD ALMIVTGLIGALSKTPLARYTWWLFSTIAFLFVLYYLLTSLRSAAAKRSEEVRSTFNTLT ALVAVLWTAYPILWIVGTEGAGVVGLGIETLAFMVLDVTAKVGFGFVLLRSRAILGETEA PEPSAGADASAAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat Transmembrane Protein 9 (TMEM9) ELISA Kit
MBS9927459 Inquire

Cat Transmembrane Protein 9 (TMEM9) ELISA Kit

Sign In for Pricing
View Details
Human TUBB Protein Lysate
MBS8429334-01 0.02 mg

Human TUBB Protein Lysate

Sign In for Pricing
View Details
Human TUBB Protein Lysate
MBS8429334-02 5x 0.02 mg

Human TUBB Protein Lysate

Sign In for Pricing
View Details
25iP-NBOMe (hydrochloride)
HY-W720337-01 5 mg

25iP-NBOMe (hydrochloride)

Sign In for Pricing
View Details
25iP-NBOMe (hydrochloride)
HY-W720337-02 10 mg

25iP-NBOMe (hydrochloride)

Sign In for Pricing
View Details
25iP-NBOMe (hydrochloride)
HY-W720337-03 25 mg

25iP-NBOMe (hydrochloride)

Sign In for Pricing
View Details