Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobaculum parvum Cobalamin synthase (cobS)

This Recombinant Chlorobaculum parvum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B3QNS4

Expression Region

1-254

Origin

Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSGLVTALRTLTVLPVPGRDAERFSSSLYWFPVVGLVIGGIVVLFARAGMGAGWPELAA VLALLGGFILTRGLHADGLADLADGFFGGRNREAALRIMKDPNVGSFGSLALIGVMLFKW ICLLELARAGAYGMIAAGVVLSRTAQVLLAARMPYARSEGGTATAFVEDAGWPHLLVASV SGVVLLFVLLDWQVVPSSILLFGSVVALFFVGWLSHRKIGGITGDVLGACSELVEIAVWF VAALWLKGLFSAIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem159 (NM_145586) Mouse Tagged ORF Clone
MG201254 10 µg

Tmem159 (NM_145586) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), CF640R conjugate, 0.1mg/mL
BNC403776-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PECR Antibody
OC-315-01 50 μL

PECR Antibody

Sign In for Pricing
View Details
PECR Antibody
OC-315-02 100 µL

PECR Antibody

Sign In for Pricing
View Details
PECR Antibody
OC-315-03 1 mL

PECR Antibody

Sign In for Pricing
View Details
Alternative Block ELISA Blocking Buffer
6299 100 mL

Alternative Block ELISA Blocking Buffer

Sign In for Pricing
View Details