Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelodictyon phaeoclathratiforme Cobalamin synthase (cobS)

This Recombinant Pelodictyon phaeoclathratiforme Cobalamin synthase (cobS) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B4SH93

Expression Region

1-254

Origin

Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSGLVTALRTLTLFPVPGKETDTFSRSLFWFPVVGLLLGSIQAALGYFTSLLGWNELSA AFVVLGGIALTRGMHADGLADLADGFWGGRTRESALRIMKDPNVGSFGAIALSGMMLLKW IAILKLVDIGAFACIAAGVLLARWVQVLLASALPYARREGGTAQSFVSGAGVVHIVVTSA LTLLFLFPLLHADLYANLYAVVAMISAALAAALLTGLLSYRKIGGVTGDVLGAGSEVTEL FVWIAAALSAALKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ezrin / p81 (CPTC-Ezrin-1), Biotin conjugate, 0.1mg/mL
BNCB2238-500 1x 500 µL

Ezrin / p81 (CPTC-Ezrin-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Aebp2 activation kit by CRISPRa
GA200112 1 Kit

Mouse Aebp2 activation kit by CRISPRa

Sign In for Pricing
View Details
HCG-alpha (HCGa/53), CF488A conjugate, 0.1mg/mL
BNC880053-100 1x 100 µL

HCG-alpha (HCGa/53), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Ep-CAM/CD326 Antibody Pair Set
E-KAB-0422 50 µL & 100 µg

Human Ep-CAM/CD326 Antibody Pair Set

Sign In for Pricing
View Details
Recombinant Human RPE Protein (His Tag)
PKSH030953 100 µg

Recombinant Human RPE Protein (His Tag)

Sign In for Pricing
View Details
Fosnetupitant
TRC-P831730-10MG 10 mg

Fosnetupitant

Sign In for Pricing
View Details