Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelodictyon phaeoclathratiforme Cobalamin synthase (cobS)

This Recombinant Pelodictyon phaeoclathratiforme Cobalamin synthase (cobS) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B4SH93

Expression Region

1-254

Origin

Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSGLVTALRTLTLFPVPGKETDTFSRSLFWFPVVGLLLGSIQAALGYFTSLLGWNELSA AFVVLGGIALTRGMHADGLADLADGFWGGRTRESALRIMKDPNVGSFGAIALSGMMLLKW IAILKLVDIGAFACIAAGVLLARWVQVLLASALPYARREGGTAQSFVSGAGVVHIVVTSA LTLLFLFPLLHADLYANLYAVVAMISAALAAALLTGLLSYRKIGGVTGDVLGAGSEVTEL FVWIAAALSAALKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanoma Marker (PNL2), CF647 conjugate, 0.1mg/mL
BNC470894-100 1x 100 µL

Melanoma Marker (PNL2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RANKL (TNFSF11) Rabbit Polyclonal Antibody
AP06633PU-N 100 µg

RANKL (TNFSF11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse LH (Luteinizing Hormone) CLIA Kit
E-CL-M0053-01 24 Tests

Mouse LH (Luteinizing Hormone) CLIA Kit

Sign In for Pricing
View Details
Mouse LH (Luteinizing Hormone) CLIA Kit
E-CL-M0053-02 48 Tests

Mouse LH (Luteinizing Hormone) CLIA Kit

Sign In for Pricing
View Details
Mouse LH (Luteinizing Hormone) CLIA Kit
E-CL-M0053-03 96 Tests

Mouse LH (Luteinizing Hormone) CLIA Kit

Sign In for Pricing
View Details
Recombinant ADA2 Monoclonal Antibody
AN302007L-01 50 µL

Recombinant ADA2 Monoclonal Antibody

Sign In for Pricing
View Details