Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelodictyon phaeoclathratiforme Cobalamin synthase (cobS)

This Recombinant Pelodictyon phaeoclathratiforme Cobalamin synthase (cobS) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B4SH93

Expression Region

1-254

Origin

Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSGLVTALRTLTLFPVPGKETDTFSRSLFWFPVVGLLLGSIQAALGYFTSLLGWNELSA AFVVLGGIALTRGMHADGLADLADGFWGGRTRESALRIMKDPNVGSFGAIALSGMMLLKW IAILKLVDIGAFACIAAGVLLARWVQVLLASALPYARREGGTAQSFVSGAGVVHIVVTSA LTLLFLFPLLHADLYANLYAVVAMISAALAAALLTGLLSYRKIGGVTGDVLGAGSEVTEL FVWIAAALSAALKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Breast
CB523859 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
GGA3 (NM_001172704) Human Over-expression Lysate
LY433320 100 µg

GGA3 (NM_001172704) Human Over-expression Lysate

Sign In for Pricing
View Details
Androsterone
TRC-A637535-250MG 250 mg

Androsterone

Sign In for Pricing
View Details
Ankrd39 Mouse Gene Knockout Kit (CRISPR)
KN501289 1 Kit

Ankrd39 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PGAM4 Mouse Monoclonal Antibody [Clone ID: OTI2E10]
CF810796 100 µg

PGAM4 Mouse Monoclonal Antibody [Clone ID: OTI2E10]

Sign In for Pricing
View Details
c-Kit Recombinant Rabbit Monoclonal Antibody [ST04-99]
ET1609-60 100 µL

c-Kit Recombinant Rabbit Monoclonal Antibody [ST04-99]

Sign In for Pricing
View Details