Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium tepidum Cobalamin synthase (cobS)

This Recombinant Chlorobium tepidum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8KDU6

Expression Region

1-254

Origin

Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSGLVTALRTLTALPVPGRDAERFSSSLYWFPVVGLVIGGIVVLLARAGMGVGWPELAA VLALLGGLILTRGLHADGLADLADGFFGGRTREAALRIMKDPNVGSFGSLALIGVMLFKW ICLLELARAEAYGMIAAGAVLSRTAQVLLAARMPYARSDGGTAMAFVEDAGWPHLLVASI SGVVLLFVLLDWQLAPSLILLFGSVVALFFVGWLSHRKIGGITGDVLGACSELVEAAVWL LAALWLKGLFWAIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse anti-KOD mAb (1MA)
E409C37-mA100-100 100 µL

Mouse anti-KOD mAb (1MA)

Sign In for Pricing
View Details
CCDC83 Antibody (N-term)
MBS9210270-01 0.08 mL

CCDC83 Antibody (N-term)

Sign In for Pricing
View Details
CCDC83 Antibody (N-term)
MBS9210270-02 0.4 mL

CCDC83 Antibody (N-term)

Sign In for Pricing
View Details
CCDC83 Antibody (N-term)
MBS9210270-03 5x 0.4 mL

CCDC83 Antibody (N-term)

Sign In for Pricing
View Details
Apolipoprotein H (APOH) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A11]
TA807147BM 100 µL

Apolipoprotein H (APOH) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A11]

Sign In for Pricing
View Details
Crxos Mouse shRNA Plasmid (Locus ID 546024)
TL508919 1 Kit

Crxos Mouse shRNA Plasmid (Locus ID 546024)

Sign In for Pricing
View Details