Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium tepidum Cobalamin synthase (cobS)

This Recombinant Chlorobium tepidum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8KDU6

Expression Region

1-254

Origin

Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSGLVTALRTLTALPVPGRDAERFSSSLYWFPVVGLVIGGIVVLLARAGMGVGWPELAA VLALLGGLILTRGLHADGLADLADGFFGGRTREAALRIMKDPNVGSFGSLALIGVMLFKW ICLLELARAEAYGMIAAGAVLSRTAQVLLAARMPYARSDGGTAMAFVEDAGWPHLLVASI SGVVLLFVLLDWQLAPSLILLFGSVVALFFVGWLSHRKIGGITGDVLGACSELVEAAVWL LAALWLKGLFWAIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat PRMT1 shRNA Plasmid
abx986044-01 150 µg

Rat PRMT1 shRNA Plasmid

Sign In for Pricing
View Details
Rat PRMT1 shRNA Plasmid
abx986044-02 300 µg

Rat PRMT1 shRNA Plasmid

Sign In for Pricing
View Details
p38 Rabbit pAb
MBS8539985-01 0.1 mL

p38 Rabbit pAb

Sign In for Pricing
View Details
p38 Rabbit pAb
MBS8539985-02 0.1 mL (AF405L)

p38 Rabbit pAb

Sign In for Pricing
View Details
p38 Rabbit pAb
MBS8539985-03 0.1 mL (AF405S)

p38 Rabbit pAb

Sign In for Pricing
View Details
p38 Rabbit pAb
MBS8539985-04 0.1 mL (AF610)

p38 Rabbit pAb

Sign In for Pricing
View Details