Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium sp. Archaerhodopsin-1 (bop)

This Recombinant Halobacterium sp. Archaerhodopsin-1 (bop) spans the amino acid sequence from region 7-260.

Product Specifications

Product Name Alternative

Archaerhodopsin-1, AR 1, Bacterio-opsin

UniProt

P69052

Expression Region

7-260

Origin

Halobacterium sp. (strain SG1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TAAVGADLLGDGRPETLWLGIGTLLMLIGTFYFIVKGWGVTDKEAREYYSITILVPGIAS AAYLSMFFGIGLTEVQVGSEMLDIYYARYADWLFTTPLLLLDLALLAKVDRVSIGTLVGV DALMIVTGLVGALSHTPLARYTWWLFSTICMIVVLYFLATSLRAAAKERGPEVASTFNTL TALVLVLWTAYPILWIIGTEGAGVVGLGIETLLFMVLDVTAKVGFGFILLRSRAILGDTE APEPSAGAEASAAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tmprss6 (Transmembrane Protease, Serine 6) ELISA Kit
FY-EH4226 96 Well

Human Tmprss6 (Transmembrane Protease, Serine 6) ELISA Kit

Sign In for Pricing
View Details
Recombinant Bartonella bacilliformis 10 kDa chaperonin (groS)
MBS1035361-01 0.02 mg (E-Coli)

Recombinant Bartonella bacilliformis 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Bartonella bacilliformis 10 kDa chaperonin (groS)
MBS1035361-02 0.1 mg (E-Coli)

Recombinant Bartonella bacilliformis 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Bartonella bacilliformis 10 kDa chaperonin (groS)
MBS1035361-03 0.02 mg (Yeast)

Recombinant Bartonella bacilliformis 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Bartonella bacilliformis 10 kDa chaperonin (groS)
MBS1035361-04 0.1 mg (Yeast)

Recombinant Bartonella bacilliformis 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Bartonella bacilliformis 10 kDa chaperonin (groS)
MBS1035361-05 0.02 mg (Baculovirus)

Recombinant Bartonella bacilliformis 10 kDa chaperonin (groS)

Sign In for Pricing
View Details