Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sec-independent protein translocase protein TatC (tatC)

This Recombinant Sec-independent protein translocase protein TatC (tatC) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Sec-independent protein translocase protein TatC

UniProt

P54085

Expression Region

1-255

Origin

Azotobacter chroococcum mcd 1

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTARPDSDQDMPLVAHLTELRSRLLRSVAAVLLIFAALFYFAQDIYALVSAPLRAYLPEG ATMIATGVASPFLAPFKLTLMISLFLAMPVVLHQVWGFIAPGLYQHEKRIAMPLMASSVL LFYAGMAFAYFVVFPIMFGFFASVTPEGVAMMTDIGQYLDFVLTLFFAFGVAFEVPVATF LLIWVGIVDVASLRNSRPYVIVGCFVVGMVLTPPDVFSQTLLAVPMWLLFEIGVFFGARI RHREEPAASDGPSQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
BNC881429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL
BNC881820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF568 conjugate, 0.1mg/mL
BNC680861-500 1x 500 µL

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-100 1x 100 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details