Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q36098

Expression Region

1-255

Origin

Theileria parva

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNSAQSYLKYINIINIFETLYLFYSTGLDTLEYIDSTYKNFIIMYVNQYLLYGTTLKYL SVGEFFMNSLTIFINSIREIMTSTTMVMYAIFGMFIFSEILVFSTFIWGYFHLRLSNPIL LAELNVEAYLQISDVLNTGSILVSIILHRVQESANFETDFFMEQLLLIGFIFLSLQNDEY SLILSYVNNYWMTLYFFILTGLHSLHVCAGGIFVLIQSYFYEGDGSQRDEEFNAGVYWHF VEMIWIALTMLLFLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal SLC17A7 / VGLUT1 Antibody
APR13345G 0.05mg

Polyclonal SLC17A7 / VGLUT1 Antibody

Sign In for Pricing
View Details
OPPA01767-2UG - sRAGE Protein
OPPA01767-2UG 2 µg

OPPA01767-2UG - sRAGE Protein

Sign In for Pricing
View Details
SPAM1 Antibody, FITC conjugated
A35494-100UG 100 µg

SPAM1 Antibody, FITC conjugated

Sign In for Pricing
View Details
LINC00094 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV731017 1.0 µg DNA

LINC00094 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
NHS-LC-LC-Biotin
A8017-100 100 mg

NHS-LC-LC-Biotin

Sign In for Pricing
View Details
ENPP1, NT (ENPP1, M6S1, NPPS, PC1, PDNP1, Ectonucleotide pyrophosphatase/phosphodiesterase family member 1, Membrane component chromosome 6 surface marker 1, Phosphodiesterase I/nucleotide pyrophosphatase 1, Plasma-cell membrane glycoprotein PC-1, Alkaline phosphodiesterase I, Nucleotide pyrophosphatase) (AP) discontinued
035080-AP 200 µL

ENPP1, NT (ENPP1, M6S1, NPPS, PC1, PDNP1, Ectonucleotide pyrophosphatase/phosphodiesterase family member 1, Membrane component chromosome 6 surface marker 1, Phosphodiesterase I/nucleotide pyrophosphatase 1, Plasma-cell membrane glycoprotein PC-1, Alkaline phosphodiesterase I, Nucleotide pyrophosphatase) (AP) discontinued

Sign In for Pricing
View Details