Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q37679

Expression Region

1-255

Origin

Theileria annulata

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNSVQSDLKYINIINISETLYLFYSTGLDTLEYIDSTYKNFIIMYVNQHLLYGTTLKYL SVGEFFINSLTIFINGIRETMTSSTVIMYAIFGMFIFSEIMVFSTFIWGFFHFRLSNPVM IIEVNLEAFLQISDVLNAGSILISLILQRIEERGYFEVDYMLERLILIGFIFLSFQGDEY SLVKSYINNHWVTLYFNVLTGLHSLHVYVGGIFALMQAFASENCGCQKDEDFNAGMYWHF VEIIWIALTMLLFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Psychrobacter cryohalolentis Protein CrcB homolog (crcB)
MBS7012771-01 0.02 mg

Recombinant Psychrobacter cryohalolentis Protein CrcB homolog (crcB)

Sign In for Pricing
View Details
Recombinant Psychrobacter cryohalolentis Protein CrcB homolog (crcB)
MBS7012771-02 0.1 mg

Recombinant Psychrobacter cryohalolentis Protein CrcB homolog (crcB)

Sign In for Pricing
View Details
Recombinant Psychrobacter cryohalolentis Protein CrcB homolog (crcB)
MBS7012771-03 5x 0.1 mg

Recombinant Psychrobacter cryohalolentis Protein CrcB homolog (crcB)

Sign In for Pricing
View Details
PhoP Antibody
orb862606-01 50 μL

PhoP Antibody

Sign In for Pricing
View Details
PhoP Antibody
orb862606-02 100 µL

PhoP Antibody

Sign In for Pricing
View Details
Phenylalanyl tRNA Synthetase Beta (FARSb), Recombinant, Mouse, His-Tag
051447-01 10 µg

Phenylalanyl tRNA Synthetase Beta (FARSb), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details