Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q37679

Expression Region

1-255

Origin

Theileria annulata

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNSVQSDLKYINIINISETLYLFYSTGLDTLEYIDSTYKNFIIMYVNQHLLYGTTLKYL SVGEFFINSLTIFINGIRETMTSSTVIMYAIFGMFIFSEIMVFSTFIWGFFHFRLSNPVM IIEVNLEAFLQISDVLNAGSILISLILQRIEERGYFEVDYMLERLILIGFIFLSFQGDEY SLVKSYINNHWVTLYFNVLTGLHSLHVYVGGIFALMQAFASENCGCQKDEDFNAGMYWHF VEIIWIALTMLLFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF594 conjugate, 0.1mg/mL
BNC941803-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GelDry Film 11 X 12 cm
EC-612 50 Sheets

GelDry Film 11 X 12 cm

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2790), 0.2mg/mL
BNUB2790-500 1x 500 µL

CD63 (Late Endosomes Marker) (LAMP3/2790), 0.2mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), CF405S conjugate, 0.1mg/mL
BNC041537-500 1x 500 µL

Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (BX006 + 2H12), CF405S conjugate, 0.1mg/mL
BNC040752-100 1x 100 µL

Bcl-x (BX006 + 2H12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD51 / Integrin V (ITGAV/1610), 0.2mg/mL
BNUB1610-500 1x 500 µL

CD51 / Integrin V (ITGAV/1610), 0.2mg/mL

Sign In for Pricing
View Details