Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carboxydothermus hydrogenoformans Cobalamin synthase (cobS)

This Recombinant Carboxydothermus hydrogenoformans Cobalamin synthase (cobS) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q3AE01

Expression Region

1-255

Origin

Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTTFLLGLTFFTRIPVPGKLNFSEEKFNRAPIFLPAYGLVTGGILALIIELFGRSFPGF FWAGVIIAGQIYLSGALHIDGLLDSLDAIYSNRDREKRLEILKDSRVGSMAVAFFGAFLI LKYGSYASFTPKVQAFTVLISEIILRGTGYLVIYSFPYVGSSLGRGFKDNASTAGLIFTL GQTLIFTLGAAAFFNFSLIKILIILLLAYLFAFVVAARWQQFFGGLTGDNYGGIMELTGL FVPVAVLLINNIGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam124a ORF Vector (Mouse) (pORF)
ORF044306 1.0 µg DNA

Fam124a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Hlx shRNA (UAS) - Lentiviral mouse Hlx shRNA (UAS, iRFP) (100)
GTR15241779 1 Vial

Lentiviral mouse Hlx shRNA (UAS) - Lentiviral mouse Hlx shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Lentiviral human PPP1R9B shRNA (UAS) - Lentiviral human PPP1R9B shRNA (UAS, RFP) plasmid
GTR15334096 1 Vial

Lentiviral human PPP1R9B shRNA (UAS) - Lentiviral human PPP1R9B shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
PCYT2 Rabbit pAb, PerCP-Cy7 conjugated
orb2879679 100 µL

PCYT2 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
KLHL3 siRNA (Human)
CRH8777-01 15 nmol

KLHL3 siRNA (Human)

Sign In for Pricing
View Details
KLHL3 siRNA (Human)
CRH8777-02 30 nmol

KLHL3 siRNA (Human)

Sign In for Pricing
View Details