Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium halobium Halorhodopsin (hop)

This Recombinant Halobacterium halobium Halorhodopsin (hop) spans the amino acid sequence from region 22-276.

Product Specifications

Product Name Alternative

Halorhodopsin, HR

UniProt

Q48315

Expression Region

22-276

Origin

Halobacterium halobium (strain port)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EIQSNFLLNSSIWVNIALAGVVILLFVAMGRDIESPRAKLIWVATMLVPLVSISSYAGLA SGLTVGFLQMPPGHALAGQEVLSPWGRYLTWTFSTPMILLALGLLADTDIASLFTAITMD IGMCVTGLAAALITSSHLLRWVFYGISCAFFVAVLYVLLVQWPADAEAAGTSEIFGTLKI LTVVLWLGYPILWALGSEGVALLSVGVTSWGYSGLDILAKYVFAFLLLRWVAANEGAVSG SGMSIGSGGAAPADD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Barbituric Acid 99% For Synthesis
00327 00100 100 g

Barbituric Acid 99% For Synthesis

Sign In for Pricing
View Details
YLF-466D 50mg
A16284-50 50 mg

YLF-466D 50mg

Sign In for Pricing
View Details
Noradrenaline transporter (SLC6A2) (NM_001043) Human Over-expression Lysate
LS006530-20ug 20 µg

Noradrenaline transporter (SLC6A2) (NM_001043) Human Over-expression Lysate

Sign In for Pricing
View Details
CASTOR2 (NM_001145064) Human Tagged ORF Clone
RG227131 10 µg

CASTOR2 (NM_001145064) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human Putative alpha-1-antitrypsin-related protein, SERPINA2 ELISA KIT
E6041Hu-01 48 Well

Human Putative alpha-1-antitrypsin-related protein, SERPINA2 ELISA KIT

Sign In for Pricing
View Details
Human Putative alpha-1-antitrypsin-related protein, SERPINA2 ELISA KIT
E6041Hu-02 96 Well

Human Putative alpha-1-antitrypsin-related protein, SERPINA2 ELISA KIT

Sign In for Pricing
View Details