Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium halobium Halorhodopsin (hop)

This Recombinant Halobacterium halobium Halorhodopsin (hop) spans the amino acid sequence from region 22-276.

Product Specifications

Product Name Alternative

Halorhodopsin, HR

UniProt

Q48315

Expression Region

22-276

Origin

Halobacterium halobium (strain port)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EIQSNFLLNSSIWVNIALAGVVILLFVAMGRDIESPRAKLIWVATMLVPLVSISSYAGLA SGLTVGFLQMPPGHALAGQEVLSPWGRYLTWTFSTPMILLALGLLADTDIASLFTAITMD IGMCVTGLAAALITSSHLLRWVFYGISCAFFVAVLYVLLVQWPADAEAAGTSEIFGTLKI LTVVLWLGYPILWALGSEGVALLSVGVTSWGYSGLDILAKYVFAFLLLRWVAANEGAVSG SGMSIGSGGAAPADD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

α-D-Glucose 1-phosphate dipotassium salt
sc-214447 500 mg

α-D-Glucose 1-phosphate dipotassium salt

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans gly-4 Polyclonal Antibody
MBS9001892 Inquire

Rabbit anti-Caenorhabditis elegans gly-4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti- human Eukaryotic initiation factor 4A-II polyclonal Antibody
MBS715216-01 0.05 mg

Rabbit anti- human Eukaryotic initiation factor 4A-II polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti- human Eukaryotic initiation factor 4A-II polyclonal Antibody
MBS715216-02 0.1 mg

Rabbit anti- human Eukaryotic initiation factor 4A-II polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti- human Eukaryotic initiation factor 4A-II polyclonal Antibody
MBS715216-03 5x 0.1 mg

Rabbit anti- human Eukaryotic initiation factor 4A-II polyclonal Antibody

Sign In for Pricing
View Details
ETFDH Human Recombinant Protein
TP726122 50 µg

ETFDH Human Recombinant Protein

Sign In for Pricing
View Details