Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium halobium Halorhodopsin (hop)

This Recombinant Halobacterium halobium Halorhodopsin (hop) spans the amino acid sequence from region 22-276.

Product Specifications

Product Name Alternative

Halorhodopsin, HR

UniProt

Q48315

Expression Region

22-276

Origin

Halobacterium halobium (strain port)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EIQSNFLLNSSIWVNIALAGVVILLFVAMGRDIESPRAKLIWVATMLVPLVSISSYAGLA SGLTVGFLQMPPGHALAGQEVLSPWGRYLTWTFSTPMILLALGLLADTDIASLFTAITMD IGMCVTGLAAALITSSHLLRWVFYGISCAFFVAVLYVLLVQWPADAEAAGTSEIFGTLKI LTVVLWLGYPILWALGSEGVALLSVGVTSWGYSGLDILAKYVFAFLLLRWVAANEGAVSG SGMSIGSGGAAPADD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1A1 (m) : 293T Lysate
sc-118332 100 µg - 200 µL

ALDH1A1 (m) : 293T Lysate

Sign In for Pricing
View Details
PKR Rabbit Monoclonal Antibody
E56G4620 100 µL

PKR Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Canine L-Selectin (L-Sel) ELISA kit
EIA05985Ca 1 Kit

Canine L-Selectin (L-Sel) ELISA kit

Sign In for Pricing
View Details
Anti-Human CD198/CCR8 Antibody (21360), APC
HW444137-01 1 Each

Anti-Human CD198/CCR8 Antibody (21360), APC

Sign In for Pricing
View Details
Anti-Human CD198/CCR8 Antibody (21360), APC
HW444137-02 100 Tests

Anti-Human CD198/CCR8 Antibody (21360), APC

Sign In for Pricing
View Details
Recombinant Mouse Calbindin (Calb1)
MBS964982-01 0.02 mg (E-Coli)

Recombinant Mouse Calbindin (Calb1)

Sign In for Pricing
View Details