Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane transport permease yadH (yadH)

This Recombinant Inner membrane transport permease yadH (yadH) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Inner membrane transport permease yadH

UniProt

P0AFN8

Expression Region

1-256

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNLIGSRIGDMHGFSYMQ FIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHVIIAGYVGGGVARGLFV GILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVFAKTFDDISLVPTFVLTP LTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGINDVPLVTTFGVLVVFIVAF YLICWSLIQRGRGLRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (CD68/G2), CF568 conjugate, 0.1mg/mL
BNC680919-100 1x 100 µL

CD68 (CD68/G2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSD17B2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E9]
TA504616BM 100 µL

HSD17B2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E9]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782P-01 20 Tests

PE/Elab Fluor® 594 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782P-02 100 Tests

PE/Elab Fluor® 594 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782P-03 2x 100 Tests

PE/Elab Fluor® 594 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
LRRC58 (NM_001099678) Human Over-expression Lysate
LC420490 20 µg

LRRC58 (NM_001099678) Human Over-expression Lysate

Sign In for Pricing
View Details