Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane transport permease yadH (yadH)

This Recombinant Inner membrane transport permease yadH (yadH) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Inner membrane transport permease yadH

UniProt

P0AFN9

Expression Region

1-256

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNLIGSRIGDMHGFSYMQ FIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHVIIAGYVGGGVARGLFV GILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVFAKTFDDISLVPTFVLTP LTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGINDVPLVTTFGVLVVFIVAF YLICWSLIQRGRGLRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FREM3 (NM_001168235) Human Over-expression Lysate
LY433743 100 µg

FREM3 (NM_001168235) Human Over-expression Lysate

Sign In for Pricing
View Details
Azilsartan Kamedoxomil (>90%)
TRC-A965605-50MG 50 mg

Azilsartan Kamedoxomil (>90%)

Sign In for Pricing
View Details
CD117 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F6]
TA801131BM 100 µL

CD117 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F6]

Sign In for Pricing
View Details
PCBP2 (NM_031989) Human Over-expression Lysate
LY403134 100 µg

PCBP2 (NM_031989) Human Over-expression Lysate

Sign In for Pricing
View Details
Snx1 Mouse Gene Knockout Kit (CRISPR)
KN516421 1 Kit

Snx1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human METRN activation kit by CRISPRa
GA112306 1 Kit

Human METRN activation kit by CRISPRa

Sign In for Pricing
View Details