Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q7M8Z9

Expression Region

1-256

Origin

Wolinella succinogenes

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIFHAIILGIVEGLTEFLPVSSTGHLILVSELLGIKQDDFHKTFEISIQLGSILAVLAL FRERLFSGVDIWLKLAVAFIPTGALGFLLYKHVKALFAPSTVAYALILGGIVFLVLEWLH KDKEYKINSVESIGYKEALAIGFFQALAMIPGTSRSGSTIVGGLILGLNRKVAAEFSFLL ALPTMFIATGYDLYKNSHTLSIENLSALGVGFVVAFIFAMIAVKGFLKFISRFNFVPFGI YRIILGIIFLFYLDLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp1a Antibody, Biotin conjugated
CSB-PA20839D0Rb-01 50 µg

Cyp1a Antibody, Biotin conjugated

Sign In for Pricing
View Details
Cyp1a Antibody, Biotin conjugated
CSB-PA20839D0Rb-02 100 µg

Cyp1a Antibody, Biotin conjugated

Sign In for Pricing
View Details
YLR120W-A Antibody
orb850145 2 mg

YLR120W-A Antibody

Sign In for Pricing
View Details
GMPS (GMP Synthase [Glutamine-hydrolyzing], Glutamine Amidotransferase, GMP Synthetase) (FITC)
127407-FITC 100 µL

GMPS (GMP Synthase [Glutamine-hydrolyzing], Glutamine Amidotransferase, GMP Synthetase) (FITC)

Sign In for Pricing
View Details
MOAP1 (Modulator of Apoptosis 1, MAP-1, PNMA4) (MaxLight 650)
248831-ML650 100 µL

MOAP1 (Modulator of Apoptosis 1, MAP-1, PNMA4) (MaxLight 650)

Sign In for Pricing
View Details
Ku70 / XRCC6 Rabbit pAb
E47R2295 100 µL

Ku70 / XRCC6 Rabbit pAb

Sign In for Pricing
View Details