Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q7M8Z9

Expression Region

1-256

Origin

Wolinella succinogenes

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIFHAIILGIVEGLTEFLPVSSTGHLILVSELLGIKQDDFHKTFEISIQLGSILAVLAL FRERLFSGVDIWLKLAVAFIPTGALGFLLYKHVKALFAPSTVAYALILGGIVFLVLEWLH KDKEYKINSVESIGYKEALAIGFFQALAMIPGTSRSGSTIVGGLILGLNRKVAAEFSFLL ALPTMFIATGYDLYKNSHTLSIENLSALGVGFVVAFIFAMIAVKGFLKFISRFNFVPFGI YRIILGIIFLFYLDLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1530 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV636597 1.0 µg DNA

Olr1530 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
MIR3670-2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV732966 1.0 µg DNA

MIR3670-2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Cenexin1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-62040R-BF647 100 µL

Cenexin1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Human RCN2 qPCR Primer Pair
QH21493S 200 Tests

Human RCN2 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Mouse Ubiquitin carboxyl-terminal hydrolase 47 (Usp47) , partial
MBS1412078 Inquire

Recombinant Mouse Ubiquitin carboxyl-terminal hydrolase 47 (Usp47) , partial

Sign In for Pricing
View Details
DHDH Conjugated Antibody
C42959 100 µL

DHDH Conjugated Antibody

Sign In for Pricing
View Details