Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Gamma-secretase subunit APH-1B (APH1B)

This Recombinant Pongo abelii Gamma-secretase subunit APH-1B (APH1B) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Gamma-secretase subunit APH-1B, APH-1b, Aph-1beta

UniProt

Q5RDM3

Expression Region

1-257

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVII DNKDGPTQKYLLIFGTFVSVYIQEMFRFAYYRLLKKASEGLKSINPGETAPSMRLLAYVS GLGFGIMSGVFSFVNTLSDSLGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDG CEKKKWGILLIVLLTHLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKL CLLCQDKDFLLYNQRSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMP2 Mouse Monoclonal Antibody [C9-9]
M1603-5 100 µL

LAMP2 Mouse Monoclonal Antibody [C9-9]

Sign In for Pricing
View Details
Human DPY30 activation kit by CRISPRa
GA113637 1 Kit

Human DPY30 activation kit by CRISPRa

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF640R conjugate, 0.1mg/mL
BNC402259-500 1x 500 µL

Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C5R1 (C5AR1) (NM_001736) Human Recombinant Protein
TP303784 20 µg

C5R1 (C5AR1) (NM_001736) Human Recombinant Protein

Sign In for Pricing
View Details
Carbocyclic Thromboxane A2
TRC-C178783-5MG 5 mg

Carbocyclic Thromboxane A2

Sign In for Pricing
View Details
Human TARC (Thymus Activation Regulated Chemokine) CLIA Kit
E-CL-H0026-01 24 Tests

Human TARC (Thymus Activation Regulated Chemokine) CLIA Kit

Sign In for Pricing
View Details