Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Gamma-secretase subunit APH-1B (APH1B)

This Recombinant Pongo abelii Gamma-secretase subunit APH-1B (APH1B) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Gamma-secretase subunit APH-1B, APH-1b, Aph-1beta

UniProt

Q5RDM3

Expression Region

1-257

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVII DNKDGPTQKYLLIFGTFVSVYIQEMFRFAYYRLLKKASEGLKSINPGETAPSMRLLAYVS GLGFGIMSGVFSFVNTLSDSLGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDG CEKKKWGILLIVLLTHLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKL CLLCQDKDFLLYNQRSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EDG8 (S1PR5) activation kit by CRISPRa
GA110021 1 Kit

Human EDG8 (S1PR5) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS711983 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Telomerase reverse transcriptase (TERT) (597-611) Goat Polyclonal Antibody
AP31849PU-N 100 µg

Telomerase reverse transcriptase (TERT) (597-611) Goat Polyclonal Antibody

Sign In for Pricing
View Details
2,5-Dihydroxy-1,4-benzoquinone
TRC-D447105-5G 5 g

2,5-Dihydroxy-1,4-benzoquinone

Sign In for Pricing
View Details
HLA-DQ (MHC II) (HLA-DQA1/2866R), CF568 conjugate, 0.1mg/mL
BNC682866-500 1x 500 µL

HLA-DQ (MHC II) (HLA-DQA1/2866R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Fkbp5 activation kit by CRISPRa
GA201430 1 Kit

Mouse Fkbp5 activation kit by CRISPRa

Sign In for Pricing
View Details