Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Gamma-secretase subunit APH-1B (APH1B)

This Recombinant Pongo abelii Gamma-secretase subunit APH-1B (APH1B) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Gamma-secretase subunit APH-1B, APH-1b, Aph-1beta

UniProt

Q5RDM3

Expression Region

1-257

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVII DNKDGPTQKYLLIFGTFVSVYIQEMFRFAYYRLLKKASEGLKSINPGETAPSMRLLAYVS GLGFGIMSGVFSFVNTLSDSLGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDG CEKKKWGILLIVLLTHLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKL CLLCQDKDFLLYNQRSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carabron
TRC-C177555-2.5MG 2.5 mg

Carabron

Sign In for Pricing
View Details
Nfu1 (NM_020045) Mouse Tagged ORF Clone
MG201993 10 µg

Nfu1 (NM_020045) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Biotin Anti-Human CD32 Antibody[IV-3]
E-AB-F1075B-01 25 µg

Biotin Anti-Human CD32 Antibody[IV-3]

Sign In for Pricing
View Details
Biotin Anti-Human CD32 Antibody[IV-3]
E-AB-F1075B-02 100 µg

Biotin Anti-Human CD32 Antibody[IV-3]

Sign In for Pricing
View Details
Integrin alpha 5 (ITGA5) Mouse Monoclonal Antibody [Clone ID: NKI-SAM1]
AM32393PU-N 1 mL

Integrin alpha 5 (ITGA5) Mouse Monoclonal Antibody [Clone ID: NKI-SAM1]

Sign In for Pricing
View Details
Human Pericentrin 1 (NUP85) activation kit by CRISPRa
GA112719 1 Kit

Human Pericentrin 1 (NUP85) activation kit by CRISPRa

Sign In for Pricing
View Details