Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gamma-secretase subunit APH-1B (Aph1b)

This Recombinant Mouse Gamma-secretase subunit APH-1B (Aph1b) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Gamma-secretase subunit APH-1B, APH-1b, Aph-1beta

UniProt

Q8C7N7

Expression Region

1-257

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAAVFFGCAFIAFGPALALYVFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVIT DNRDGPVQNYLLIFGVLLSVCIQELFRLAYYKLLKKASEGLKSINPEETAPSMRLLAYVS GLGFGIMSGVFSFVNTLSNSLGPGTVGIHGDSPQFFLNSAFMTLVVIMLHVFWGVVFFDG CEKNKWYTLLTVLLTHLVVSTQTFLSPYYEVNLVTAYIIMVLMGIWAFYVAGGSCRSLKL CLLCQDKDFLLYNQRSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fruit fly ssp3 Antibody, Carrier-free
DZ41327-carrier-free 200 µL/Vial

Anti-Fruit fly ssp3 Antibody, Carrier-free

Sign In for Pricing
View Details
BIN2 antibody - middle region (ARP56880_P050)
ARP56880_P050 100 µL

BIN2 antibody - middle region (ARP56880_P050)

Sign In for Pricing
View Details
Lentiviral human ARHGEF2 shRNA (UAS) - Lentiviral human ARHGEF2 shRNA (UAS) plasmid
GTR15084499 1 Vial

Lentiviral human ARHGEF2 shRNA (UAS) - Lentiviral human ARHGEF2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Mycobacterium Avium Uncharacterized protein MAV321 Protein(aa 1-306)
VAng-Yyj1498-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Avium Uncharacterized protein MAV321 Protein(aa 1-306)

Sign In for Pricing
View Details
CYP27B1 (NM_000785) Human Tagged ORF Clone Lentiviral Particle
RC222840L1V 200 µL

CYP27B1 (NM_000785) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Pitpna sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6807905 3x 1.0 µg

Pitpna sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details