Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gamma-secretase subunit APH-1B (Aph1b)

This Recombinant Mouse Gamma-secretase subunit APH-1B (Aph1b) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Gamma-secretase subunit APH-1B, APH-1b, Aph-1beta

UniProt

Q8C7N7

Expression Region

1-257

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAAVFFGCAFIAFGPALALYVFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVIT DNRDGPVQNYLLIFGVLLSVCIQELFRLAYYKLLKKASEGLKSINPEETAPSMRLLAYVS GLGFGIMSGVFSFVNTLSNSLGPGTVGIHGDSPQFFLNSAFMTLVVIMLHVFWGVVFFDG CEKNKWYTLLTVLLTHLVVSTQTFLSPYYEVNLVTAYIIMVLMGIWAFYVAGGSCRSLKL CLLCQDKDFLLYNQRSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nanos2 Antibody
24701 100 µL

Nanos2 Antibody

Sign In for Pricing
View Details
March2 Protein Vector (Rat) (pPB-N-His)
PV281175 500 ng

March2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
SARM Antibody
orb75812 100 µL

SARM Antibody

Sign In for Pricing
View Details
CLUAP1 Peptide - C-terminal region
MBS3237027-01 0.1 mg

CLUAP1 Peptide - C-terminal region

Sign In for Pricing
View Details
CLUAP1 Peptide - C-terminal region
MBS3237027-02 5x 0.1 mg

CLUAP1 Peptide - C-terminal region

Sign In for Pricing
View Details
DPYSL3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
18584064 1.0 µg DNA

DPYSL3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details