Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Flagellar biosynthetic protein fliR (fliR)

This Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Flagellar biosynthetic protein fliR (fliR) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein fliR

UniProt

Q89AZ0

Expression Region

1-257

Origin

Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFQFNFNDFILFIYNLFFPAVRILALFSTAPLFNSKFIEKKIKLIMAFVISWIFSSFLPK VNIAIFSVDGILIIIEQMLIGILLGLTMQLIFSSIFMSGEIISLQMGLSFSSLFDFNSRS NLSALSHFVHIFLLLLFLEWNGHIWMLSALFDTFITIPIQKIYLDPNIFLKVVNFSKYIF FDSIMLLFPIIIVQLLLNLSIGILNRVAPQISILSLGFTVTLLVGIILLYFFIPIFPSSC IVIFRRLQSFVLTLFNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-500 1x 500 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-500 1x 500 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details