Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM57A (FAM57A)

This Recombinant Human Protein FAM57A (FAM57A) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Protein FAM57A, Protein CT120

UniProt

Q8TBR7

Expression Region

1-257

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLTLAGGALFFPGLFALCTWALRRSQPGWSRTDCVMISTRLVSSVHAVLATGSGIVIIR SCDDVITGRHWLAREYVWFLIPYMIYDSYAMYLCEWCRTRDQNRAPSLTLRNFLSRNRLM ITHHAVILFVLVPVAQRLRGDLGDFFVGCIFTAELSTPFVSLGRVLIQLKQQHTLLYKVN GILTLATFLSCRILLFPFMYWSYGRQQGLSLLQVPFSIPFYCNVANAFLVAPQIYWFCLL CRKAVRLFDTPQAKKDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-100 1x 100 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD29 (Stem Cell Marker) (12G10), CF647 conjugate, 0.1mg/mL
BNC472905-500 1x 500 µL

CD29 (Stem Cell Marker) (12G10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details