Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yhfC (yhfC)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yhfC (yhfC) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yhfC

UniProt

O07601

Expression Region

1-258

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSQEAVVFLALSGAIAFLLPIGLIVWFKRKYGASLKVFFIGALTFFVFAQLLEGGVHVY VLQVNEMTKEAMQHPLWYGIYGCLMAGIFEECGRYLMMRFFMKRHHTWADGLAFGAGHGG LEAILITGLSSISLIVYAFAINSGTFEQLLVNGDVKQALLPIQEQLLHTPSYEWMLGGIE RISAIAVQIGLSLLVLYAVKNRRPLFLLYSILLHALFNVPAVLYQRGIIEHAAAVEIIVA LIAALSVYWIVKAKRVFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2-Ethyl-1,3-oxazol-5-yl) methanamine
GYB98250-01 50 mg

(2-Ethyl-1,3-oxazol-5-yl) methanamine

Sign In for Pricing
View Details
(2-Ethyl-1,3-oxazol-5-yl) methanamine
GYB98250-02 0.5 g

(2-Ethyl-1,3-oxazol-5-yl) methanamine

Sign In for Pricing
View Details
ENTPD5 Antibody
CSB-PA929748-01 50 μL

ENTPD5 Antibody

Sign In for Pricing
View Details
ENTPD5 Antibody
CSB-PA929748-02 100 µL

ENTPD5 Antibody

Sign In for Pricing
View Details
L (+) -Amethopterin hydrate
FA32143-01 25 g

L (+) -Amethopterin hydrate

Sign In for Pricing
View Details
L (+) -Amethopterin hydrate
FA32143-02 50 g

L (+) -Amethopterin hydrate

Sign In for Pricing
View Details