Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Cobalamin synthase (cobS)

This Recombinant Methanocaldococcus jannaschii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q58833

Expression Region

1-258

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGITMFKEFKALLSFFTRIPIYVEDFDFENIANYFYLIILIGYVFGIFSLILGYIFSFLL PNFLSAVLILFFIEYLNGFHHIDGLIDFGDGWMAVGDKRKKLMAMKDRYIGCGGVVFAIF FNLMAVISLSYILDINILYLLVGEVCAKLGMLSCSTFGNPLIEGTGRYFVKKADEKFLTI GIILSLPLLLIFSGIERKIVIIAIITTIITGLCMAKIAKRHFGGVNGDVLGASNEITRVV VLLSIIASIKVFSIYLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Fumarase /fumarate Hydratase FUM ELISA Kit
BG-POR11022 1 Each

Porcine Fumarase /fumarate Hydratase FUM ELISA Kit

Sign In for Pricing
View Details
NAP1L1 Antibody
A53219-50UL 50 μL

NAP1L1 Antibody

Sign In for Pricing
View Details
Human P4HA3 Knockout A549 cell line
GTR15408898 1 Vial

Human P4HA3 Knockout A549 cell line

Sign In for Pricing
View Details
OTSSP167 25mg
A12851-25 25 mg

OTSSP167 25mg

Sign In for Pricing
View Details
Abemaciclib Impurity 94
RM-A305094-01 10 mg

Abemaciclib Impurity 94

Sign In for Pricing
View Details
Abemaciclib Impurity 94
RM-A305094-02 100 mg

Abemaciclib Impurity 94

Sign In for Pricing
View Details