Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Cobalamin synthase (cobS)

This Recombinant Methanocaldococcus jannaschii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q58833

Expression Region

1-258

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGITMFKEFKALLSFFTRIPIYVEDFDFENIANYFYLIILIGYVFGIFSLILGYIFSFLL PNFLSAVLILFFIEYLNGFHHIDGLIDFGDGWMAVGDKRKKLMAMKDRYIGCGGVVFAIF FNLMAVISLSYILDINILYLLVGEVCAKLGMLSCSTFGNPLIEGTGRYFVKKADEKFLTI GIILSLPLLLIFSGIERKIVIIAIITTIITGLCMAKIAKRHFGGVNGDVLGASNEITRVV VLLSIIASIKVFSIYLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit B-cell leukemia/lymphoma 2 (Bcl-2) Elisa Kit
EK70028Rb 96 Well

Rabbit B-cell leukemia/lymphoma 2 (Bcl-2) Elisa Kit

Sign In for Pricing
View Details
Rabbi! anti-56K2 Antibody, Affinity Purified
A300-576A-T 2 µg

Rabbi! anti-56K2 Antibody, Affinity Purified

Sign In for Pricing
View Details
BTLA Rabbit pAb
E45R20038N-50 50 µL

BTLA Rabbit pAb

Sign In for Pricing
View Details
Serum Amyloid A (SAA) Deficient Human Plasma Lyophilized 1mL
ISAADPLY1ML 1 mL

Serum Amyloid A (SAA) Deficient Human Plasma Lyophilized 1mL

Sign In for Pricing
View Details
RBM41 HDR Plasmid (m)
sc-433533-HDR 20 µg

RBM41 HDR Plasmid (m)

Sign In for Pricing
View Details
Lentiviral mouse Camkk1 shRNA (UAS) - Lentiviral mouse Camkk1 shRNA (UAS) (25)
GTR15254933 1 Vial

Lentiviral mouse Camkk1 shRNA (UAS) - Lentiviral mouse Camkk1 shRNA (UAS) (25)

Sign In for Pricing
View Details