Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Gamma-secretase subunit Aph-1b (aph1b)

This Recombinant Danio rerio Gamma-secretase subunit Aph-1b (aph1b) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Gamma-secretase subunit Aph-1b, Anterior-pharynx-defective protein 1b

UniProt

Q8JHE9

Expression Region

1-258

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVAVFFGCTFIAFGPAIALFMFTIARDPLRVIFLIAGAFFWLVSLLLSSLVWFITVQIS NKNSATQQRGLLIFGVVLSVLLQEAFRYGYYRLLKKANEGLLALSQEDTMPISMRQLAYV SGLGFGFMSGAFSVVNILSDSLGPGTVGIHGESQHYFISSAFMTLAIILLHMFWGVVFFE ACERQRWWALGAVVASHLVVSCLTFVNPHYQGSLIPTYIILSVMAVWAYLCAGGSLRNLK LCLTCKDKDFLLANHRPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERRFI1 (NM_018948) Human Over-expression Lysate
LY402716 100 µg

ERRFI1 (NM_018948) Human Over-expression Lysate

Sign In for Pricing
View Details
Low Temperature Circulator BCLT-2104
BCLT-2104 1 Unit

Low Temperature Circulator BCLT-2104

Sign In for Pricing
View Details
2-Chloro-1,3,2-dioxaphospholane-2-oxide (Technical Grade)
TRC-C365758-5G 5 g

2-Chloro-1,3,2-dioxaphospholane-2-oxide (Technical Grade)

Sign In for Pricing
View Details
PPP3CB (NM_001142353) Human Over-expression Lysate
LY428053 100 µg

PPP3CB (NM_001142353) Human Over-expression Lysate

Sign In for Pricing
View Details
GALE Human Gene Knockout Kit (CRISPR)
KN401561 1 Kit

GALE Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse S100 Calcium Binding Protein A11 (S100A11) ELISA Kit
RDR-S100A11-Mu-01 96 Tests

Mouse S100 Calcium Binding Protein A11 (S100A11) ELISA Kit

Sign In for Pricing
View Details