Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Gamma-secretase subunit Aph-1b (aph1b)

This Recombinant Danio rerio Gamma-secretase subunit Aph-1b (aph1b) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Gamma-secretase subunit Aph-1b, Anterior-pharynx-defective protein 1b

UniProt

Q8JHE9

Expression Region

1-258

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVAVFFGCTFIAFGPAIALFMFTIARDPLRVIFLIAGAFFWLVSLLLSSLVWFITVQIS NKNSATQQRGLLIFGVVLSVLLQEAFRYGYYRLLKKANEGLLALSQEDTMPISMRQLAYV SGLGFGFMSGAFSVVNILSDSLGPGTVGIHGESQHYFISSAFMTLAIILLHMFWGVVFFE ACERQRWWALGAVVASHLVVSCLTFVNPHYQGSLIPTYIILSVMAVWAYLCAGGSLRNLK LCLTCKDKDFLLANHRPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF488A conjugate, 0.1mg/mL
BNC881387-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAFAH1B3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B3]
TA804471AM 100 µL

PAFAH1B3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B3]

Sign In for Pricing
View Details
GRP94 (HSP90B1) (NM_003299) Human Over-expression Lysate
LY418780 100 µg

GRP94 (HSP90B1) (NM_003299) Human Over-expression Lysate

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1945), CF405S conjugate, 0.1mg/mL
BNC041945-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1945), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FKLF / KLF11 (KLF11) Mouse Monoclonal Antibody [Clone ID: OTI5A1]
CF811002 100 µg

FKLF / KLF11 (KLF11) Mouse Monoclonal Antibody [Clone ID: OTI5A1]

Sign In for Pricing
View Details
5alpha-Cholestan-3beta-ol
TRC-C431710-10G 10 g

5alpha-Cholestan-3beta-ol

Sign In for Pricing
View Details