Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Gamma-secretase subunit Aph-1b (aph1b)

This Recombinant Danio rerio Gamma-secretase subunit Aph-1b (aph1b) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Gamma-secretase subunit Aph-1b, Anterior-pharynx-defective protein 1b

UniProt

Q8JHE9

Expression Region

1-258

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVAVFFGCTFIAFGPAIALFMFTIARDPLRVIFLIAGAFFWLVSLLLSSLVWFITVQIS NKNSATQQRGLLIFGVVLSVLLQEAFRYGYYRLLKKANEGLLALSQEDTMPISMRQLAYV SGLGFGFMSGAFSVVNILSDSLGPGTVGIHGESQHYFISSAFMTLAIILLHMFWGVVFFE ACERQRWWALGAVVASHLVVSCLTFVNPHYQGSLIPTYIILSVMAVWAYLCAGGSLRNLK LCLTCKDKDFLLANHRPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBA2 Rabbit Polyclonal Antibody
TA365917 100 µL

GBA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FLI1 Rabbit Polyclonal Antibody
AP06124PU-N 100 µg

FLI1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HERC2 Human Gene Knockout Kit (CRISPR)
KN420214 1 Kit

HERC2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Carcino Embryonic Antigen CEA (CD66e) Antibody
OC-175-01 50 μL

Carcino Embryonic Antigen CEA (CD66e) Antibody

Sign In for Pricing
View Details
Carcino Embryonic Antigen CEA (CD66e) Antibody
OC-175-02 100 µL

Carcino Embryonic Antigen CEA (CD66e) Antibody

Sign In for Pricing
View Details
Carcino Embryonic Antigen CEA (CD66e) Antibody
OC-175-03 1 mL

Carcino Embryonic Antigen CEA (CD66e) Antibody

Sign In for Pricing
View Details