Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Putative gamma-secretase subunit APH-1C (Aph1c)

This Recombinant Mouse Putative gamma-secretase subunit APH-1C (Aph1c) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Putative gamma-secretase subunit APH-1C

UniProt

Q9DCZ9

Expression Region

1-258

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLPVFFGCAFIAFGPAFALYLFTIATDPLRVIFLIAGAFFWLVSLLLSSMFWFLVRVIT NNRDESVQNYLLIFGALLSVCIQELFRLAYYKLLKKASEGLKSINPEEDIAPSMRLLAYV SGLGFGIMSGVFSFVNTLSNSLGPGTVGIHGDSPQFFLNSAFMTLVVIMLHVFWGVVFFD GCEKNKWYTLLTVLLTHLVVSTQTFLSPYYEVNLVTAYIIMVLMGIWAFYVAGGSCRSLK FCLLCQDKDFLLYNQRSR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Setd7 Pre-designed siRNA Set A
SI112768A 1 Each

Mouse Setd7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PNLIP Antibody, Biotin conjugated
A31505-100UG 100 µg

PNLIP Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal CD200R1 Antibody (118) [Janelia Fluor 549]
NBP2-89845JF549 0.1 mL

Rabbit Monoclonal CD200R1 Antibody (118) [Janelia Fluor 549]

Sign In for Pricing
View Details
Bovine Thyroxine-Binding Globulin, TBG ELISA Kit
MBS165681-01 48 Well

Bovine Thyroxine-Binding Globulin, TBG ELISA Kit

Sign In for Pricing
View Details
Bovine Thyroxine-Binding Globulin, TBG ELISA Kit
MBS165681-02 96 Well

Bovine Thyroxine-Binding Globulin, TBG ELISA Kit

Sign In for Pricing
View Details
Bovine Thyroxine-Binding Globulin, TBG ELISA Kit
MBS165681-03 5x 96 Well

Bovine Thyroxine-Binding Globulin, TBG ELISA Kit

Sign In for Pricing
View Details