Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Putative gamma-secretase subunit APH-1C (Aph1c)

This Recombinant Mouse Putative gamma-secretase subunit APH-1C (Aph1c) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Putative gamma-secretase subunit APH-1C

UniProt

Q9DCZ9

Expression Region

1-258

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLPVFFGCAFIAFGPAFALYLFTIATDPLRVIFLIAGAFFWLVSLLLSSMFWFLVRVIT NNRDESVQNYLLIFGALLSVCIQELFRLAYYKLLKKASEGLKSINPEEDIAPSMRLLAYV SGLGFGIMSGVFSFVNTLSNSLGPGTVGIHGDSPQFFLNSAFMTLVVIMLHVFWGVVFFD GCEKNKWYTLLTVLLTHLVVSTQTFLSPYYEVNLVTAYIIMVLMGIWAFYVAGGSCRSLK FCLLCQDKDFLLYNQRSR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF483 (Zinc Finger Protein 483, KIAA1962, Zinc Finger Protein with KRAB and SCAN Domains 16, ZKSCAN16, ZSCAN48)
MBS642905-01 0.1 mg

ZNF483 (Zinc Finger Protein 483, KIAA1962, Zinc Finger Protein with KRAB and SCAN Domains 16, ZKSCAN16, ZSCAN48)

Sign In for Pricing
View Details
ZNF483 (Zinc Finger Protein 483, KIAA1962, Zinc Finger Protein with KRAB and SCAN Domains 16, ZKSCAN16, ZSCAN48)
MBS642905-02 5x 0.1 mg

ZNF483 (Zinc Finger Protein 483, KIAA1962, Zinc Finger Protein with KRAB and SCAN Domains 16, ZKSCAN16, ZSCAN48)

Sign In for Pricing
View Details
Lentiviral human CRP sgRNA gene knockout kit - Lentiviral human CRP sgRNA gene knockout kit (25)
GTR15378417 1 Vial

Lentiviral human CRP sgRNA gene knockout kit - Lentiviral human CRP sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
FATP4 Recombinant Antibody
bsm-62978R-TR 20 µL

FATP4 Recombinant Antibody

Sign In for Pricing
View Details
Phosphodiesterase 6H cGMP-Specific Cone Gamma Human Recombinant
rAP-1098 1 Each

Phosphodiesterase 6H cGMP-Specific Cone Gamma Human Recombinant

Sign In for Pricing
View Details
KRIBIOLISA™ Human Claudin 18.2 ELISA
KBGT903 1x 96 Well

KRIBIOLISA™ Human Claudin 18.2 ELISA

Sign In for Pricing
View Details