Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halothermothrix orenii Undecaprenyl-diphosphatase (uppP)

This Recombinant Halothermothrix orenii Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B8CWG2

Expression Region

1-259

Origin

Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIFKVIFLGIIQGLTEFLPISSSGHLVLFQELLGINTDQITLDVFLHFGTVIPVLIIFW DDVRDIIFFKKEKRWLTILILVGIIPTGIIGILFEDFFANLFSSVKTVGFMLLVTGFLLY LSEKLSNYNKELKEMQYHNALIVGVAQGMAIIPGISRSGSTIVASLLQGFDRDAAARYSF LLSAPVIFGAGLVELKDALSTGLEQLTWLSIIIGTIFAALSGYFAIKYLLYILRKGKLTV FAYYCWIVGIMIIILAGIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-100 1x 100 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-100 1x 100 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-500 1x 500 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF488A conjugate, 0.1mg/mL
BNC882035-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF488A conjugate, 0.1mg/mL
BNC882400-500 1x 500 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF647 conjugate, 0.1mg/mL
BNC470774-500 1x 500 µL

HSP27 (HSPB1/774), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details