Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M2 Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Streptococcus pyogenes serotype M2 Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q1JHX9

Expression Region

1-259

Origin

Streptococcus pyogenes serotype M2 (strain MGAS10270)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPIALKCGPLAIHWYALCILSGLVLAVYLASKEAPKKGISSDAIFDFILIAFPLAIVG ARIYYVIFEWSYYVKHLDEIIAIWNGGIAIYGGLITGALVLLAYCYNKVLNPIHFLDIAA PSVMVAQAIGRWGNFINQEAYGKAVSQLNYLPSFIQKQMFIEGSYRIPTFLYESLWNLLG FVIIMMWRRKPKSLLDGEIFAFYLIWYGSGRLVIEGMRTDSLMFLGIRISQYVSALLIII GLIFVIKRRRQKGISYYQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBS: 10mM Phosphate, 137 mM NaCl, 2.7 mM KCl, pH 7.4
PBS-50 1000 PCS/Case

PBS: 10mM Phosphate, 137 mM NaCl, 2.7 mM KCl, pH 7.4

Sign In for Pricing
View Details
ADAM17 Peptide
orb1234678 0.1 mg

ADAM17 Peptide

Sign In for Pricing
View Details
Ethyl Carbazate 97.0%
084625-01 25 g

Ethyl Carbazate 97.0%

Sign In for Pricing
View Details
Ethyl Carbazate 97.0%
084625-02 100 g

Ethyl Carbazate 97.0%

Sign In for Pricing
View Details
Human Procollagen C-Endopeptidase Enhancer 2 / PCPE2 (PCOLCE2) Protein
abx068674-01 10 µg

Human Procollagen C-Endopeptidase Enhancer 2 / PCPE2 (PCOLCE2) Protein

Sign In for Pricing
View Details
Human Procollagen C-Endopeptidase Enhancer 2 / PCPE2 (PCOLCE2) Protein
abx068674-02 50 µg

Human Procollagen C-Endopeptidase Enhancer 2 / PCPE2 (PCOLCE2) Protein

Sign In for Pricing
View Details