Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M2 Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Streptococcus pyogenes serotype M2 Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q1JHX9

Expression Region

1-259

Origin

Streptococcus pyogenes serotype M2 (strain MGAS10270)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPIALKCGPLAIHWYALCILSGLVLAVYLASKEAPKKGISSDAIFDFILIAFPLAIVG ARIYYVIFEWSYYVKHLDEIIAIWNGGIAIYGGLITGALVLLAYCYNKVLNPIHFLDIAA PSVMVAQAIGRWGNFINQEAYGKAVSQLNYLPSFIQKQMFIEGSYRIPTFLYESLWNLLG FVIIMMWRRKPKSLLDGEIFAFYLIWYGSGRLVIEGMRTDSLMFLGIRISQYVSALLIII GLIFVIKRRRQKGISYYQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD147/BSG Antibody (SAA0061), PerCP
HW664147-01 1 Each

Anti-Human CD147/BSG Antibody (SAA0061), PerCP

Sign In for Pricing
View Details
Anti-Human CD147/BSG Antibody (SAA0061), PerCP
HW664147-02 100 Tests

Anti-Human CD147/BSG Antibody (SAA0061), PerCP

Sign In for Pricing
View Details
Mouse 4-Hydroxynonenal,4HNE ELISA Kit
YLA0573MO-01 48 Tests

Mouse 4-Hydroxynonenal,4HNE ELISA Kit

Sign In for Pricing
View Details
Mouse 4-Hydroxynonenal,4HNE ELISA Kit
YLA0573MO-02 96 Tests

Mouse 4-Hydroxynonenal,4HNE ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti ANXA5 Polyclonal Affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (Western Blot,IHC)
IRBAMLANXA5AP114120UL 1 Each

Rabbit Anti ANXA5 Polyclonal Affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (Western Blot,IHC)

Sign In for Pricing
View Details
SNAP23 Antibody (C-term)
MBS9208919-01 0.08 mL

SNAP23 Antibody (C-term)

Sign In for Pricing
View Details