Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M2 Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Streptococcus pyogenes serotype M2 Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q1JHX9

Expression Region

1-259

Origin

Streptococcus pyogenes serotype M2 (strain MGAS10270)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPIALKCGPLAIHWYALCILSGLVLAVYLASKEAPKKGISSDAIFDFILIAFPLAIVG ARIYYVIFEWSYYVKHLDEIIAIWNGGIAIYGGLITGALVLLAYCYNKVLNPIHFLDIAA PSVMVAQAIGRWGNFINQEAYGKAVSQLNYLPSFIQKQMFIEGSYRIPTFLYESLWNLLG FVIIMMWRRKPKSLLDGEIFAFYLIWYGSGRLVIEGMRTDSLMFLGIRISQYVSALLIII GLIFVIKRRRQKGISYYQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH889
EHC17907-01 25 mg

IDH889

Sign In for Pricing
View Details
IDH889
EHC17907-02 50 mg

IDH889

Sign In for Pricing
View Details
TMED5 (NM_001167830) Human Tagged ORF Clone
RC229667 10 µg

TMED5 (NM_001167830) Human Tagged ORF Clone

Sign In for Pricing
View Details
ACSL4 CRISPR Knock Out 293T Cell Line (Human)
11216141 1x 10^6 Cells / 1.0 mL

ACSL4 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human FGF7 ELISA Kit
orb1809410 96 Tests

Human FGF7 ELISA Kit

Sign In for Pricing
View Details
ATP6AP1 (V-type Proton ATPase Subunit S1, V-ATPase Subunit S1, Protein XAP-3, V-ATPase Ac45 Subunit, V-ATPase S1 Accessory Protein, Vacuolar Proton Pump Subunit S1, ATP6IP1, ATP6S1, VATPS1, XAP3) (MaxLight 550)
MBS6370723-01 0.1 mL

ATP6AP1 (V-type Proton ATPase Subunit S1, V-ATPase Subunit S1, Protein XAP-3, V-ATPase Ac45 Subunit, V-ATPase S1 Accessory Protein, Vacuolar Proton Pump Subunit S1, ATP6IP1, ATP6S1, VATPS1, XAP3) (MaxLight 550)

Sign In for Pricing
View Details