Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M4 Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Streptococcus pyogenes serotype M4 Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q1J7Q5

Expression Region

1-259

Origin

Streptococcus pyogenes serotype M4 (strain MGAS10750)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPIALKCGPLAIHWYALCILSGLVLAVYLASKEAPKKGISSDAIFDFILIAFPLAIVG ARIYYVIFEWSYYVKHLDEIIAIWNGGIAIYGGLITGALVLLAYCYNKVLNPIHFLDIAA PSVMVAQAIGRWGNFINQEAYGKAVSQLNYLPSFIQKQMFIEGSYRIPTFLYESFWNLLG FVIIMMWRRKPKSLLDGEIFAFYLIWYGSGRLVIEGMRTDSLMFLGIRISQYVSALLIII GLIFVIKRRRQKGISYYQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-100 1x 100 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-100 1x 100 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-100 1x 100 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details