Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant O-antigen export system permease protein rfbD (rfbD)

This Recombinant O-antigen export system permease protein rfbD (rfbD) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

O-antigen export system permease protein rfbD

UniProt

Q56902

Expression Region

1-259

Origin

Yersinia enterocolitica

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLVINDLLKSLHHLPLIFHMAYSDTKARYKRSMLGPLWLTLGAAVGVVGLGLVWSQLLH QERSELIPSLTIGLLLWQFISGCVIESTSTFVKQSQIIRNLQLPFFIHPIQLIVRQSITL AHNLIVLVVVLIIYPQNLGLVSILSIVGFAIVLINLLWISVMLSIIGARFRDVEQIVQAL MPIIFFLTPVLYKAGHAGVNQAIIWLNPFTYFITLVRDPIFGNIPAVFVYQITIGMAIVG WGLTLIIFNRFAPRIAFWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WWS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2645606 1.0 µg DNA

WWS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
GLIS3 Antibody
A63409-50UG 50 µg

GLIS3 Antibody

Sign In for Pricing
View Details
Porcine ADP ribosylation factor like protein 1 (ARL1) ELISA Kit
GTR10329632 96 Well

Porcine ADP ribosylation factor like protein 1 (ARL1) ELISA Kit

Sign In for Pricing
View Details
Anti-Cdk9 Antibody Picoband® (iFluor647 Conjugate)
PB9537-iFluor647 100 µg

Anti-Cdk9 Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
Tesmin CRISPR Activation Plasmid (h)
sc-410474-ACT 20 µg

Tesmin CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
1700037C18Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)
10228094 4x 500 ng

1700037C18Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details