Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant O-antigen export system permease protein rfbD (rfbD)

This Recombinant O-antigen export system permease protein rfbD (rfbD) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

O-antigen export system permease protein rfbD

UniProt

Q56902

Expression Region

1-259

Origin

Yersinia enterocolitica

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLVINDLLKSLHHLPLIFHMAYSDTKARYKRSMLGPLWLTLGAAVGVVGLGLVWSQLLH QERSELIPSLTIGLLLWQFISGCVIESTSTFVKQSQIIRNLQLPFFIHPIQLIVRQSITL AHNLIVLVVVLIIYPQNLGLVSILSIVGFAIVLINLLWISVMLSIIGARFRDVEQIVQAL MPIIFFLTPVLYKAGHAGVNQAIIWLNPFTYFITLVRDPIFGNIPAVFVYQITIGMAIVG WGLTLIIFNRFAPRIAFWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac Mono(5-carboxy-2-ethylpentyl) Phthalate
TRC-M525550-2.5MG 2.5 mg

rac Mono(5-carboxy-2-ethylpentyl) Phthalate

Sign In for Pricing
View Details
BCAT2 (Branched Chain Aminotransferase 2, Mitochondrial, BCAM, BCT2) (MaxLight 750)
MBS6371088-01 0.1 mL

BCAT2 (Branched Chain Aminotransferase 2, Mitochondrial, BCAM, BCT2) (MaxLight 750)

Sign In for Pricing
View Details
BCAT2 (Branched Chain Aminotransferase 2, Mitochondrial, BCAM, BCT2) (MaxLight 750)
MBS6371088-02 5x 0.1 mL

BCAT2 (Branched Chain Aminotransferase 2, Mitochondrial, BCAM, BCT2) (MaxLight 750)

Sign In for Pricing
View Details
SRPK2 Rabbit Polyclonal Antibody (RBITC)
orb1039005 100 µL

SRPK2 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
GAL3 ELISA Kit| Monkey Galectin 3 ELISA Kit
EF012698 96 Tests

GAL3 ELISA Kit| Monkey Galectin 3 ELISA Kit

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Photosystem II reaction center protein H (psbH)
MBS7027892-01 0.02 mg

Recombinant Prochlorococcus marinus Photosystem II reaction center protein H (psbH)

Sign In for Pricing
View Details