Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cobalamin synthase (cobS)

This Recombinant Prochlorococcus marinus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q7VDR6

Expression Region

1-259

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSPNWLKDLTGAWLFYTVFPKLTRINPRFERIARFSPLIGVLIGVLQVSVLILLLQLQW PNESMPFIAIALGLWITGGIHVDGLMDTADGIAAGPSRCIEAMKDSRIGASGIIALTINL LLQIAALFKLRLLILFAIPIASFWGRYSQIWAISHYPYLNKEGSSKFLHKKNWRGFLIES IPSYAFLSFLIFILINIDISIISTPNLIIGIIVGFLPALIIPHLLARRLGGHSGDSYGAS VVLVETCMLIIFSIILPAS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Miopithecus talapoin C-C chemokine receptor type 5 (CCR5), partial
MBS7096100 Inquire

Recombinant Miopithecus talapoin C-C chemokine receptor type 5 (CCR5), partial

Sign In for Pricing
View Details
NH2-PEG6-Boc
BA2461-5000 5 g

NH2-PEG6-Boc

Sign In for Pricing
View Details
Recombinant Anopheles gambiae NADH-ubiquinone oxidoreductase chain 6 (mt:ND6)
MBS7021385-01 0.02 mg

Recombinant Anopheles gambiae NADH-ubiquinone oxidoreductase chain 6 (mt:ND6)

Sign In for Pricing
View Details
Recombinant Anopheles gambiae NADH-ubiquinone oxidoreductase chain 6 (mt:ND6)
MBS7021385-02 0.1 mg

Recombinant Anopheles gambiae NADH-ubiquinone oxidoreductase chain 6 (mt:ND6)

Sign In for Pricing
View Details
Recombinant Anopheles gambiae NADH-ubiquinone oxidoreductase chain 6 (mt:ND6)
MBS7021385-03 5x 0.1 mg

Recombinant Anopheles gambiae NADH-ubiquinone oxidoreductase chain 6 (mt:ND6)

Sign In for Pricing
View Details
Recombinant Rat Cathepsin K
MBS9420156-01 0.02 mg

Recombinant Rat Cathepsin K

Sign In for Pricing
View Details