Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides sp. Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Dehalococcoides sp. Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A5FQU1

Expression Region

1-260

Origin

Dehalococcoides sp. (strain BAV1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEINVDPVAFSIGSLVVKWYGIMMALGVVALVSWIFWRIKRGANISYDTVLTAAIIAIP SGIVFAKLLHVIDAWEYYSLNPGAIFSGEGLTIFGAIIGATIGLWIYSRYSHFNLGYLLD VAVPGILLGQAIGRVGCLLNGCCYGEFGGTGCSVIYTNPATAAPYGVEVAPTQAYEIIFL LCLLTFSLFIAKKLRPDGQLFLLYISLYAAWRVAIGFVRVNDDFALGLEQAQVVGLILMA VAVPLFIYRLRKQKQTDKIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-500 1x 500 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF568 conjugate, 0.1mg/mL
BNC680201-100 1x 100 µL

CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details